No Result
View All Result
Newsletter
lifestyle blog
  • Home
    • Home – Layout 1
    • Home – Layout 2
    • Home – Layout 3
    • Home – Layout 4
    • Home – Layout 5
  • Fashion
  • Beauty
    • All
    • Beauty
    • Celebrity
    How to Use Earthy Color Palettes to Make Your Home a Calm, Cozy Retreat

    How to Use Earthy Color Palettes to Make Your Home a Calm, Cozy Retreat

    Poppy Liu on the Fashion, Fun, and Anti-Capitalist Heart of ‘I Love Boosters’

    Poppy Liu on the Fashion, Fun, and Anti-Capitalist Heart of ‘I Love Boosters’

    A Beginner’s Guide to Undetectable Men’s Makeup

    A Beginner’s Guide to Undetectable Men’s Makeup

    Gnome More Rules: A Day at Chelsea Flower Show With the Unbanned Garden Gnomes

    Gnome More Rules: A Day at Chelsea Flower Show With the Unbanned Garden Gnomes

    For Men, It’s Going to Be a Big Shorts Summer

    For Men, It’s Going to Be a Big Shorts Summer

    Peptide Lip Liners Are Quietly Taking Over

    Peptide Lip Liners Are Quietly Taking Over

    Trending Tags

    • Best Dressed
    • Oscars 2017
    • Golden Globes
    • Fashion Week
    • Red Carpet
    • D.I.Y. Fashion
    • Celebrity Style
  • Celebrity
  • Health & Fitness
  • Lifestyle
  • Travel
  • Home
    • Home – Layout 1
    • Home – Layout 2
    • Home – Layout 3
    • Home – Layout 4
    • Home – Layout 5
  • Fashion
  • Beauty
    • All
    • Beauty
    • Celebrity
    How to Use Earthy Color Palettes to Make Your Home a Calm, Cozy Retreat

    How to Use Earthy Color Palettes to Make Your Home a Calm, Cozy Retreat

    Poppy Liu on the Fashion, Fun, and Anti-Capitalist Heart of ‘I Love Boosters’

    Poppy Liu on the Fashion, Fun, and Anti-Capitalist Heart of ‘I Love Boosters’

    A Beginner’s Guide to Undetectable Men’s Makeup

    A Beginner’s Guide to Undetectable Men’s Makeup

    Gnome More Rules: A Day at Chelsea Flower Show With the Unbanned Garden Gnomes

    Gnome More Rules: A Day at Chelsea Flower Show With the Unbanned Garden Gnomes

    For Men, It’s Going to Be a Big Shorts Summer

    For Men, It’s Going to Be a Big Shorts Summer

    Peptide Lip Liners Are Quietly Taking Over

    Peptide Lip Liners Are Quietly Taking Over

    Trending Tags

    • Best Dressed
    • Oscars 2017
    • Golden Globes
    • Fashion Week
    • Red Carpet
    • D.I.Y. Fashion
    • Celebrity Style
  • Celebrity
  • Health & Fitness
  • Lifestyle
  • Travel
No Result
View All Result
lifestyle blog

Poppy Liu on the Fashion, Fun, and Anti-Capitalist Heart of ‘I Love Boosters’

admin by admin
0
Home Beauty
Share on FacebookShare on Twitter

In the brand-new crime comedy I Love Boosters, director Boots Riley presents a vision of rebellion against the capitalist scheme that’s not only highly principled in its execution, but dripping with fantastically fashionable, faux-fur-trimmed, Technicolor glamour, too.

As Jianhu—a former Chinese factory worker who flees to the Bay Area to join a crew of professional shoplifters—Poppy Liu (whom you may also recognize from Hacks) is known for speaking out about the political issues that matter most to her, and in I Love Boosters, she joins a stacked cast to bring to life a script that confronts those issues head-on.

“None of us did this movie to make money,” Liu says, “but I think it’s my favorite job I’ve ever done.” Here, she tells Vogue all about it.

Vogue: How did you prepare to portray Jianhu in I Love Boosters?

Poppy Liu: I respect Boots [Riley] so much as an artist and a creative for how he uses his voice and artistry for social commentary, and I feel a lot of alignment with him politically, so we really got into it. The movie covers so much; not just the critique of capitalism, but also the class solidarity piece and the relational global solidarity piece between the US and China, which I think is really huge. I think the thesis that he’s making with the film is kind of a “Workers of the world unite” thing, where we’re kind of held apart by the same forces and systems of power, but for the character herself, she isn’t really thinking about any of this. She’s just a girl in China who works in a factory and likes to mess around and fuck off and be a young kid, and you kind of see her get radicalized in real time because she’s seeing what’s happening to her family and loved ones and feels the need to do something about it.

Tell me about Jianhu’s political evolution throughout the film.

Even by the end of the film, I don’t think Jianhu is someone who necessarily self-identifies as an activist or an organizer or a revolutionary, but all of her actions are that, because I think at the heart of all of those identities is someone who dares to imagine the world to be better than it is, and takes action in that direction, however big or small. The minute she appears, she has this laser focus on wanting to get labor rights for her people at the factory in China by any means necessary, and she’s tremendously brave. Still, I don’t think she’s thinking about herself in that way; she’s just like, “We want longer breaks, better working hours, better pay, and stop making us use chemicals that give us diseases and cancer.” They’re all tangible things, not classroom-revolutionary stuff where you’re sort of theorizing about it. That’s important too, but I think Jianhu is very much someone who’s just out here and doing the thing. She’s very action-oriented, and I really love her a lot as a character.

#Poppy #Liu #Fashion #Fun #AntiCapitalist #Heart #Love #Boosters

Tags: AntiCapitalistBoostersfashionFunHeartLiuLovePoppysplitscreenimageleftinsettv & moviesweb
Previous Post

A Beginner’s Guide to Undetectable Men’s Makeup

Next Post

How to Use Earthy Color Palettes to Make Your Home a Calm, Cozy Retreat

admin

admin

Next Post
How to Use Earthy Color Palettes to Make Your Home a Calm, Cozy Retreat

How to Use Earthy Color Palettes to Make Your Home a Calm, Cozy Retreat

Leave a Reply Cancel reply

Your email address will not be published. Required fields are marked *

Search

No Result
View All Result

About Me

lifestyle blog

Mocha Rose

Fashion Blogger & Traveler

Hello & welcome to my blog! My name is Mocha Rose and I'm a 20-year-old independent blogger with a passion for sharing about fashion and lifestyle.

Instagram

    Go to the Customizer > JNews : Social, Like & View > Instagram Feed Setting, to connect your Instagram account.

Facebook

@Instagram

    Go to the Customizer > JNews : Social, Like & View > Instagram Feed Setting, to connect your Instagram account.
Facebook Twitter VK Tumblr Pinterest Instagram RSS

About Me

Hi, my name is Don Voleng. I am love blogging about forthcoming trends and news in fashion, art, music, and culture, coffee addict.

Read my full story.

Categories

  • Beauty
  • Celebrity

Tags

beauty Collection digital_syndication Fall Fall 2026 Menswear Fall 2026 Ready-to-Wear fashion Hair Latest Makeup Menswear nutrition onecolumn opinion PreFall ReadytoWear runway runway_review Season shopping skin splitscreenimagerightfullbleed splitscreenimagerightinset Spring Spring 2026 Ready-to-Wear storytype:category guide & comparison storytype:interview storytype:list storytype:news & trending storytype:reporting Style textabovecenterfullbleed textaboveleftsmall Travel tv & movies Vogue vogue parties web Wedding Week wellness _commerce _sensitivecontent _seo _syndication_noshow

© 2026 JNews - Premium WordPress news & magazine theme by Jegtheme.

No Result
View All Result
  • Home
    • Home – Layout 1
    • Home – Layout 2
    • Home – Layout 3
    • Home – Layout 4
    • Home – Layout 5
  • Fashion
  • Beauty
  • Celebrity
  • Health & Fitness
  • Lifestyle
  • Travel

© 2026 JNews - Premium WordPress news & magazine theme by Jegtheme.